SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_131500 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_131500
Domain Number 1 Region: 132-204
Classification Level Classification E-value
Superfamily RING/U-box 0.0000068
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_131500
Sequence length 231
Comment PBANKA_131500 conserved Plasmodium protein, unknown function 13839904:13842101 forward MW:27686
Sequence
MHYQDDSPKNANENGDDMISHDDENPYFKDVWDNLERYEEEYTPSNDIIKYHSHLQKSLY
NILFSIKYFHDINIDSHFLKLVNKYVKLKLQGNQTDEKDISRLARFHLKSQKEDDDEDEL
VVDEEIGAFPTKCPISQMPFENPVTQRFSKNRKACVHTFENSFILRLIQNKDTIECPIAA
CKKKVYRNSLHPDYELLHHSRFMKFRDNITEAKEYFEKLRNDEDKCFNFVE
Download sequence
Identical sequences A0A077XFT0 A0A0Y9ZA80
PBANKA_131500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]