SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_132570 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_132570
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.8e-17
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_132570
Sequence length 121
Comment PBANKA_132570 thioredoxin-like protein, putative 14218840:14219205 reverse MW:14382
Sequence
MKKHDDKIYQEIQNEEEYKQLFNEKNDILYIIDVYTKWCGPCLITFEIINKIYKHNYVFC
ENVKIFSVCAQTVASLKNYDNNSMPFYIILKNGEIIQQVQGCNTPYIFSLINEHLANKKL
N
Download sequence
Identical sequences A0A077XG78 A0A113SKH9 Q4YYY5
gi|68071493|ref|XP_677660.1| XP_677660.1.11252 PBANKA_132570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]