SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_133580 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_133580
Domain Number 1 Region: 401-518
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.8e-24
Family PDI-like 0.0012
Further Details:      
 
Domain Number 2 Region: 26-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.13e-17
Family PDI-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_133580
Sequence length 543
Comment PBANKA_133580 disulfide-isomerase, putative 14637426:14639657 reverse MW:65083
Sequence
MKCINLLIAFFILINFYYTNQDDWGKKEIVSINMDTFNRILEDQNQITLLIVYTHWCQRS
ILLLENLENISSILMYDSNINISKINVAINHEIIHIFDVYSYPSLFLIKKKQVYKYIGLN
NVQSILLWIQEYLDESIYEIKNKEKLVLFLELKEYNILTIFVIIKEKKYYNMINDLISIC
KLIENTFFFYIKDNNLITFFENAFVAKSDNLNIAEIKEKDIYGILYKNDFFDKYFYLFNN
SLNILYENESIVDDKLNALAKWINEKSEPLVIRFSEYYFSTLFSPETITLFIFYNDINEL
NKTDIIKCAKKHKMVTFAISGNVEVYEKRLLSDLLIDDIKKPIMRITQFKNDVEVPYKYK
PLSDEIEINEKTIDQFINEFLTDNKYFYKKSERILPDEYNNGYVKIIVADNYDEHIFNND
KNVVVLYYAPWCGHCHKFDPIYRRIGKRLKLYINQNEDYKNDVIISKIDAANNEIYNVPI
EGYPTIYLYEKSNKRIPIMYTEDKTEEKLISWICQMTNTNINIEKFLSINLDDEKLFENY
EEL
Download sequence
Identical sequences A0A077XIU3 A0A0Y9ZLS1
PBANKA_133580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]