SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_135640 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_135640
Domain Number 1 Region: 1039-1124,1273-1478
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-47
Family Tandem AAA-ATPase domain 0.00064
Further Details:      
 
Domain Number 2 Region: 496-522,694-814,923-1026
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-44
Family Tandem AAA-ATPase domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1188-1253
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000631
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Weak hits

Sequence:  PBANKA_135640
Domain Number - Region: 550-581
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0353
Family YdcK-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_135640
Sequence length 1482
Comment PBANKA_135640 DNA helicase, putative, pseudogene 15344660:15349228 forward MW:172052
Sequence
MTTSNYFKCENNICNESNNVSKYNYGDDVIELVNLNSNGCKPYNAKETNSLTKPSRNKAN
YNKFKESDSDVEVIGDIRIYNDKIDEIELLNKDGELIRGKGVYFEYYLGCIETDSIILSS
EICDVKNDKDISISYEITPKSTKRSYSPMYNLKINDSYISSNDYIKIIGRNIQNKTQKGK
KNVPQKKQKKENNNDSSTVCYDILSRKSNNNFNEILSSDKKYVEMNKYKCEVLKDINEGH
PCIRLKHNNRDISKLKSHLSKTLSVLLVLNAIRIEIKLEKVSLCDFKFGGSLKTFVHVIL
YPDSFKIDVHKYHEYNSLIKYSVNNLFKELKIAPLRLAKNVSSDSFDDLNTKIVTGKNFT
KNIDNFSNKYESSSVTINTNNAFYLDFALKEGTQGIIIEMIXYMFILIFVYKNVDKYYIE
FLFSLKFILSNFYFTNFCLSNSVGSSTISQGKEYEEILDTASENEVEEKNEDTTNLVFSE
EKYRGGYLLEEFKEIYPNSVYFKPTLKTYQAEGIWWMYLKENPPEYLKENIFKGEKKNEI
DLDQIIRSKSIYSEIHVYNDVYIDKEVHINSDVYIDKEVNVNKYMHNCEIYLLDMKTENE
SSNPNIKIKDENDEEYGHMNEMKNKELVKTEDYNNDDDNDIRNKEPLNPVWEEHAFIPNI
KIYEEGKLIFVLKYFYINKITGCLSLTYPQYVPQFRGGILADEMGLGKTIQSIGLIAHDI
YQNKLHIKNNNIENKNNITYLIENTIKGFAYNKGGTLIIAPLGLIYQWKQEIDKHTKEGF
ISSYIYYGSSKDINSDLLSKYSVVLTTYSTLVSEYKNTWNKILSSKPTIEVKGNATNVGK
SEYNIENKFSYTKWAKEKQEKDEKPETVDKFEEGSNNGQGKGNGIKKRKLNNFFMKSSLN
NGKNSILSSTGDKKTNKVLNSMKDYPLYKITWRRIIIDEAHVIKNKNSIQSIAVWKLRGE
RKWCLTGTPIQNSLYDIFPLLRFLGIKPYGNVEWWNKEIVDYVNRNKLNIALDIVRKISS
PILLRRTKSSKTKEGCNIITLPKKNVHILKLKFSLEEEDFYRAIFYRSKTKFDTYMHDGN
VLSHYSHVLQLLLRLRQCCSHPLLLFSKPFFEEWNDEDIINGMYEENSRITESSIDSATD
KSSIYVKLSNMKVDDTLKSDTVKNEVLKKDTLIYNFLQKSSNSNKLSSEYVEEIEMLKNG
TAMQCVICLEDSVYPLISKCLHIMCKKCADFYFNLTQIAEKKCPGCDNYISLKSLKTLQQ
NKSPLDDFLKKMKKDNFVYSTKLRILFDHIKEDIKNELHVVVFSQWIGFLKIIEKLLTLH
EIPNKIYDGSLTYEQRKSTLYWFNIQKGKIYQPGIGFCQSTCDIPIENESGKVLLCSLKA
GGVGLNLTVSSKVYLMDLWWNPAIEDQAFERIHRIGQLKDVNIYKFVLEKTVEERILQIH
QSKQYTANQCLAQVGNKISTDVNLVTQKLGMDDFILMFKDWN
Download sequence
Identical sequences PBANKA_135640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]