SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_135800 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_135800
Domain Number 1 Region: 59-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.95e-22
Family Thioltransferase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_135800
Sequence length 157
Comment PBANKA_135800 thioredoxin, putative 15427055:15428269 reverse MW:18418
Sequence
MKHILALVVFIISFFCFKDVNCIKDFQLSPIESPLTALNKYDKFFLRMYNKMPRLEQSST
DYINGINMKNTIFVLYFYAKWCHACKLQGPELDKLEKNFGKKVHIIRIDIDNNEEIAKKN
FIKALPTTIIIKNKVILAKNEHFVTSNELTSTIRKHL
Download sequence
Identical sequences A0A077XJF1 A0A0Y9ZYR1
PBANKA_135800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]