SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_136450 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PBANKA_136450
Domain Number - Region: 58-96,126-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000633
Family Glutathione S-transferase (GST), N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_136450
Sequence length 162
Comment PBANKA_136450 conserved Plasmodium protein, unknown function 15662348:15662836 forward MW:18846
Sequence
MRKIIFLIVIVLSFLGLIQNKGRTPNRNSKIKKLPVIKDSTKLISIIDKTPTKQYITYVY
HSSICSYCSLITDALKDNEHVKMIKINDDSKLEDLIKTDKPIVVILKNINKEDSVERSKF
YYELQKKGGKVRVPALEINNHIMYESKEILAFYKHLLSKFEN
Download sequence
Identical sequences Q4YAW0
PBANKA_136450 gi|68071965|ref|XP_677896.1| XP_677896.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]