SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_140640 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_140640
Domain Number 1 Region: 545-595
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000778
Family B-box zinc-binding domain 0.0032
Further Details:      
 
Weak hits

Sequence:  PBANKA_140640
Domain Number - Region: 43-89
Classification Level Classification E-value
Superfamily RING/U-box 0.00742
Family RING finger domain, C3HC4 0.048
Further Details:      
 
Domain Number - Region: 104-151
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0228
Family HSP33 redox switch-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_140640
Sequence length 775
Comment PBANKA_140640 conserved Plasmodium protein, unknown function 15970573:15973074 reverse MW:90308
Sequence
MDIISSSNNDINSEEENGFSDFENGNTQICKEDTISESCETQNNKIYRCAYCSRKVEDVL
ICSCKHLMCLTCASMQLQDKYDKFMKACSSAKIIEEKKVNYKINESFRNCIDIIDKINND
KIEDILKKEKIGYVTCNICNIKNKLTIDTLELLTKVGLFSSDVLNIHTFYFNLIGNNNKR
IKGLTENCVKQLSLEYDESYSNDMPNNRILKNDKLKQLAVSNNKYNYLEEYADDLDRYSY
ICNICSFSEAIIYCNDCIEYLCENCCNNIHEINTPNGMNSKITPHDYYKIDKKIINLKKL
VKPPKMFLNITKEDIEIIDNTDRDSFDGHFSEDDEKKRNNKIGNFKVEGGDDSDFDNYDE
KYFYEKQKKLMEKKNKKDNNIKLSHKLNNLVENMKNGSSYDSVHSTIDGTLGSISDLGAN
FLKKKKKKGNRRMRKKNMYGSKIKYGEHLNGETKMLQKREWTSLQKGKKNKIGNMNKEES
ICVFSNDETSSRVDISSSESSLNSCNSDDGEICIKNIKMESIKKKKKEIRNPSLNNDIIA
NKTFTSIENIRCNHHYNYPIQYFCHTCCTKCFCSECAINGIHTSQCNIENINAAFITVLN
NYLIQWNEVINELINDLEVNFYESLEDTRNDWSSILSECYYNISSKINYIINNMHKMEKD
IFNQLDTYMENFKKDNLDYVELLNSKYDDIENTISIIRANKFQKNPIDLIKFYNNNINII
DRTLILNKDFKPIEDLSKIRESKIFYMDLYTSQIISYLKHLQVFLSSNFLAPSIK
Download sequence
Identical sequences A0A077XHM5 A0A0Z0AD24
PBANKA_140640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]