SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_142560 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_142560
Domain Number 1 Region: 769-862
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000127
Family Cold shock DNA-binding domain-like 0.0081
Further Details:      
 
Domain Number 2 Region: 611-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000289
Family Cold shock DNA-binding domain-like 0.0095
Further Details:      
 
Domain Number 3 Region: 1069-1135
Classification Level Classification E-value
Superfamily WWE domain 0.0000523
Family WWE domain 0.011
Further Details:      
 
Weak hits

Sequence:  PBANKA_142560
Domain Number - Region: 708-766
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00357
Family Cold shock DNA-binding domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_142560
Sequence length 1137
Comment PBANKA_142560 RNA-binding protein, putative 16657521:16661810 reverse MW:135465
Sequence
MIFTKQCLFLSFFVVIVSSFLKPKLLLNNYIYSKTSQFKKRKKVINYQLLKSKDKDVESY
IPHIYKDIVPSLKELADQEYSYKQLLNAYIPETIEREKRDKLNKKINQKNSRKQSKENRK
TNNNNEVDEKEENEDNECNKDLSNNIDKMMEIKMKENDIKHFENLSEINNHKNKNKILDI
AYDVIEDTLKNTYMDQKLGLDNENNDSKKNYLEIAKKRKDLLYDKLINNYSMLNNSSTFD
LFGVFYDNNNYKDDNKLIEELDKIMNLEPFKSNKDNIDEDIDVLLKKDKIPTHIRNFILK
YKNLRKINMSNKKIHHTKKNENEQVKESGGVKQMDNDDNVDNEKEKDEENGNYENNIKDE
NGENIYNDFNRDLNKVLMTFNKNLTNEKLIKRDKYIIDELYEEYKKHIKNMSIKRNKLEP
QKDNYDFLTFVHEYGEEFFFQKYGYFDNYLKENVEKIKNKVRSENASIVSIPNIMNSESN
LEQEKSSTITKSNGPANNMGNEKDNINEDFLNDSPEKRIIKQNNRKINNEKNNTQMRNNL
DWRKESNKLESYMLSNIVHEYNKRIYDIYKPNDMITNQYGFNNYIDNEEYDIDINVSLNK
YSIMNYDSKEELNNDESLYVGKLIFGKIFRIEKNMAIVDINYSHYGEIHSDQMPYNITNI
SDVFKVNDKLIFEIYKMYPNRIELTLKNIQKINDLNKILLYKTQDIPFEVTVLSIIKNGI
TVSYNDIYTFIHISAISSKYKVIVDENETIDSNLLNKKIKVFCTDINKLSFSNLLYEQNE
QLKNINMYDVIDVEIIHISKYGIMVKYNDIVGLIHISEISRKKIENINNVFKINEKIKGM
LINIDYYNKRFSLSTKILETHDKNFIDNRDDIYNNIEHIINNIKKRSNKMEVNDSNIKNQ
LLSLIDIYKDGNGSEKMKTKEGKDETTNQHKKIQEEIKLYENEKLDKHPQVTSEKTGSQA
EHIADMKTDNNIFDGEEKYSVNSIDNHIKKIQEKDQNDDDGTLFELNQSEEEKEELSIDT
HNEIIPYLLLKKSDCNKEEHEEEKKEIVWNLDDEEFLHSNSPTQNSQYIEYQWSYLKDKK
WIPFPYNVNRIINYYFNINDDFFTYKEKNVTYEIYFAKNVRIDLSTGLQNKIRKTLK
Download sequence
Identical sequences PBANKA_142560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]