SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_144620 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_144620
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-31
Family spliceosomal protein U5-15Kd 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_144620
Sequence length 142
Comment PBANKA_144620 DIM1 protein homolog, putative 17449108:17449536 forward MW:16775
Sequence
MSFMLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYL
VDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIF
RGARKGRGLVISPKDYSTKYKY
Download sequence
Identical sequences A0A077TVB6 A0A077XKH3 A0A077YC24 A0A0Z0B3C7 A0A1C6YPW4 Q7R866 V7PS38
2687.m00028|PY07357|PY07357|Drosophila PCAS_144840 gi|82793842|ref|XP_728199.1| PBANKA_144620 XP_008622770.1.22292 XP_728199.1.76580 XP_739362.2.12432 73239.Q7R866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]