SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_144860 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PBANKA_144860
Domain Number - Region: 28-82
Classification Level Classification E-value
Superfamily Ribonuclease Rh-like 0.000236
Family Ribonuclease Rh-like 0.0072
Further Details:      
 
Domain Number - Region: 259-373
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00582
Family Thioltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_144860
Sequence length 432
Comment PBANKA_144860 conserved Plasmodium protein, unknown function 17553118:17554578 reverse MW:51855
Sequence
MGLQKFKNNLLIIRNTIKCRHKKRYGFWGSHNICSNNTDKNNLKLQINGKNEINLLKILT
NKNITSNNVTTNSDIVNTIENFRIFEKKNSLEFDRIIYKPDNYEELKEFVKGIEKNEKII
NDYEIYYYEENISNIKLNRNQEKNEIFINIEDILKDKKISSYEKKNFLEKKKINNLYYYN
IQRYEENSDPSSLLIDKRRLTKSEYRYQYISTILPYICFAFMLFFPHFLICLYIPYIKEK
NKKHREICKVIQIKQNIHLYKDIKTDNITSILDNNIKTIVLFYNSKLFLNKYIKSLMIDL
SRIFKNNSIPINIVGIDTSIQNIPYNVIKDINHNHYPLLYFILPYHYDNDSAVLKIENPF
ALENILFQIKDFVYIPETVIQQVKELSIRTKLLKKCIFEHEILGNKKEDILYEYGSELAH
FSCLQYNNKLIF
Download sequence
Identical sequences A0A077XIQ3 A0A122IZR8
PBANKA_144860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]