SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_010800 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_010800
Domain Number 1 Region: 61-201,251-283
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.65e-32
Family Nuclease 0.02
Further Details:      
 
Domain Number 2 Region: 332-382,428-521
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-16
Family Nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_010800
Sequence length 602
Comment PBANKA_010800 mitochondrial cardiolipin synthase, putative 306323:308131 reverse MW:70513
Sequence
MKVENKLRDKIYKHILNKKGEEWKEDGIDFNKLVDSNVEKLNINENDKKLIKTKWVNILK
RNAEKYGKVSEGNKIKIYNTGYACFKNILKSIDKCKKRVWFESYIFDDSDFAEQIINSLC
NASKRGCDVILLVDYIGSLKLKNKWVNKLKENNVNVIFFNTFLNSFLNILPIFFRDHRKI
IILDNSAYCGSMNVSENVIPNFSNIVRTDKDEILLNIEKECQNYHLLNEKESDNAEGYIF
TNGILGKKNKCLEYYDLHIKLKGPAVKDLADVFIDSLKMANTDITRDPIENQKKYKKNDE
DNSSCYVQVLESNVLRKIKSIQLSFEYIIKNGANNNIYITTSYFLPPGFLRRALFYALSN
GVNISFLFSGNSDIFGDVPATYYVIKKFLKKFGNEKDKVIYDNTSNNNEKISDFENRIIN
NYHNNLHSKKNKLLKWKKINFKDFKKHVEHKFGDNLLLKNKHKGTSEFFFFEKKHCHAKN
IVVDNLWCSIGSFNWDRFSSRRNLEVMVSIFDKNISDKFIKEHEEKKKNNSKQITLSNIN
NRNVLQIFFSYCAYHIGKLYGKNIFDGLSNNNKKTILRKAIINRYLADNCIDHISLNMMW
GT
Download sequence
Identical sequences A0A077X7Y8 A0A113QJU8
PBANKA_010800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]