SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_021330 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_021330
Domain Number 1 Region: 95-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.87e-26
Family Glutathione peroxidase-like 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_021330
Sequence length 245
Comment PBANKA_021330 1-cys peroxidoxin, putative 996727:997629 forward MW:28793
Sequence
MKRIIILIFPILLNVYLCFKNLAHNKSLNFVSKRWNFNNRFSHKLGESKSIDLANDIKEN
DLIPNVKVMVDVGNIGIVNNFGEEEKKSPIEESPFRSIDTHELFKSKRILLISLPGAFTP
LCTSKMIPEYEKEYDSFIRENKFDDIYCITNNDIYVLKSWFKNMDIKKIKYISDGNSSFT
ESMNMLVDKSNYFMGMRPWRYVGIVENNILIKIFQENEKQHNIQTDPYDISSADHVKEFL
KHNKI
Download sequence
Identical sequences A0A077X5T4 A0A0Y9TS44
PBANKA_021330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]