SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_040430 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_040430
Domain Number 1 Region: 415-516,664-712
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000533
Family Nucleotide and nucleoside kinases 0.033
Further Details:      
 
Domain Number 2 Region: 188-300
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000394
Family Tyrosine-dependent oxidoreductases 0.02
Further Details:      
 
Weak hits

Sequence:  PBANKA_040430
Domain Number - Region: 846-875
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_040430
Sequence length 904
Comment PBANKA_040430 P-loop containing nucleoside triphospahte hydrolase, putative 1904442:1907156 forward MW:106309
Sequence
MKIFINNINTYSGSCLCETLDIIQNEKCEIYGTLINQNEAKEEDMYMYNYNNVKKIVSKT
NKDKLVKYIVTSNLCVFDMHNTGIEEIEYVIRKLKNEEIKTKVTFILVSSIMTWNKTKRK
FVKKKIEEKIEEKIEQSDNVLTKQTNDKINSVQNCQKNNIDKYRYIPEAFSEKDYLKRIP
SSGFKELKTIEILVLSLNSIKNINTYVVASGILYGNGENVFFPIFKNAWFGKDNQIIDKG
NNFIPVIHVKGLCEYVKNVFIYKPEIKYLIAVDQEYVTQKDIIKSVANYISANNNYLSVS
SYDSIFIKDSEKLCINLRFQCTRFWNLNQVDAINEKKKDNPNVLSSDNEESGQIGENSES
EENSENEKNSENKENSENGKRGEEESCIKFHCQDGFVKNISILTKEFCEYRNLKSLKIMI
MGPPGVGKTFIGKKICEHYNLKICSIQTLLDECKKTNYKFPEYYTNNLNDVGNTNKLNLN
DISSIFYKKLKSNECKFRGYVLDSFPRNYYEAKMFFEKYFVSDVVDSSKDLTYSKNETMK
KKHKKIKNKNEKRRNSNESKHSEESEMSLSEEETESKVDDESEEDEHSDSINKKTSSQSY
TSESLDELENEDQTSENGDSSNEDRINENTKKNKKYDIKNDSEENKNNEYIYNENKNMDP
RNNPILPEFVIILKSKEDLCRIRMMNLPKDEIIKGHNDEKGFERRYNKYIEENCRNDYLE
FDKKNTIEDYFIENQIEVLNININEKSILEDILTNIYIYIEKNKKFYNFLPSTDEILKNK
LHEQEIKLLNEKENIKKNEDNTINEELNKNDELIKAEKKRQQLLMEYQQQYIHNQSLPLR
FYLIKNILPILTDALIYICKTKPKNPCLHIAEYLLENAHKYNVDENTLPLIPPKKNEDKD
SPNN
Download sequence
Identical sequences A0A077X6Z2 A0A1C6WQY3
PBANKA_040430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]