SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_070180 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PBANKA_070180
Domain Number - Region: 31-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00179
Family Thioltransferase 0.071
Further Details:      
 
Domain Number - Region: 130-179
Classification Level Classification E-value
Superfamily RING/U-box 0.0512
Family IBR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_070180
Sequence length 185
Comment PBANKA_070180 conserved Plasmodium protein, unknown function 4388909:4389739 forward MW:20990
Sequence
MEDKNIENIDEQDQAENIYYNEDQDGVTVAQEAEIVLVTTSFGGIKSSFFSSLRAQNLLN
CKKFLYFIIDSNRDTGLAKKLKDEELFNKWKDDGLLIEDEKGIILPQILIDGVAIGNDVI
LQNLEDEGNLDYIVSRLKCPNCLAEKSNTDITCPQCQYDYASLISDEMINGKEVIRMLQG
ELYED
Download sequence
Identical sequences A0A077XA63 A0A0Y9VJ69
PBANKA_070180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]