SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_082020 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_082020
Domain Number 1 Region: 43-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-16
Family Glutathione peroxidase-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_082020
Sequence length 206
Comment PBANKA_082020 thioredoxin, putative 5931146:5932066 forward MW:23413
Sequence
MSCANFNSPYQAEKRRTAENADNQNLESIKKPIDYSDMDLILFPEGSLKNINNTVVNEKH
LVGKSVALFFSNGSDPKCRAFLPFLQQYYKTINEAGSSQKIEIIFVSVDTDRASFEDHKK
HMPWLYIDVADPLTDILKKHFRVMNAYEVPFYGSGPRSDVPCLVVIGSDGREAQLLHVCS
GREEGEKGVLRWDFRNNIYSLNKKGL
Download sequence
Identical sequences A0A077X9T9 A0A0Y9W4W6 Q4YQP4
gi|68069067|ref|XP_676444.1| PBANKA_082020 XP_676444.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]