SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_102390 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_102390
Domain Number 1 Region: 87-201
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.21e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.61e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_102390
Sequence length 205
Comment PBANKA_102390 glutathione s-transferase, putative 9051584:9052391 reverse MW:24038
Sequence
MMDNIVLYYFDARGKAELIRLIFAYLQVKYTDIRFGVNGDAFAEFNNFKKEKEIPFNQVP
ILEIGGLILAQSQSIVRYLSKKYNISGNGELNEFYADMIFCGVQDIHYKFNNTNLFKQNE
TTFLNEELPKWSGYFEKLLQKNNTNYFVGDTITYADLAVFNLYYDIESKYPNCLKKFPLL
KAHTELISNIPNIKHYIANRKESVY
Download sequence
Identical sequences A0A077YDH7 A0A122IC26
PBANKA_102390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]