SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_120550 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_120550
Domain Number 1 Region: 363-460
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 3.01e-16
Family Cdc48 domain 2-like 0.0019
Further Details:      
 
Domain Number 2 Region: 584-629
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000435
Family RING finger domain, C3HC4 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_120550
Sequence length 631
Comment PBANKA_120550 conserved Plasmodium protein, unknown function 11641000:11642996 forward MW:73475
Sequence
MERKSGQSKYMHFLPIINSQTKLNILEKNNVLEKVHILPIKKRSSNFHELYNKLNKLINE
KNILYEGIVISLKDGSESSDLKISKIPHINEKEESIKIKNKINNDDVFGIDKVSTDESSA
DENQTFDVDIPLNDNDENNKNINNINSDIFKNKKDNGQKESMPQLLDNNVDYVIINCIPS
KGILNHDTLIYTDGKYVDYLKKIEIIIINDINYKKYEKNIKRKFISLKKMIIKKSNEFFN
GAMSLFPLYFNFIPELCMSKNRNKVSKNEQCSIEKIINLSTSDEYNTKKKETKKINKIHN
IITQKILTAHLIPYFKNNRNKLFYPGKLFNVYNFSFLVSKIDIDISAGFIDDLTEINLRV
DGCEAYTNVHIVPLYDTLPTTYNYNLFIDYIKPYIEKNYLNTFSIYDTFFYRGVQFKIMG
VDPIDIKCGKGRISANTSIYIQGSVKPTFFDVISNKSFNYIKSLPFEYKPYAILNILQHL
DTDSLLRLFPSANTNMEFSTKNEQNILDNLAPLMYIYNKENISYGSKLENKSLFQTSNSG
DSKDIIIEQSNAHREINNNIDKSGNDFANKKCSSKIDNNIINEQCVVCFEHFINNDKCIK
LTCFHTYHWKCVQNWFRFNLTCPCCRHKLDI
Download sequence
Identical sequences A0A077XGN3 A0A1C6YMG7
PBANKA_120550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]