SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_124370 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_124370
Domain Number 1 Region: 91-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000553
Family Thioltransferase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_124370
Sequence length 202
Comment PBANKA_124370 conserved Plasmodium protein, unknown function 13070063:13070816 reverse MW:24251
Sequence
MYIYTFIYLYMSRILRRMLFLPLFSTAIIYLFIRNSLLSYIFIKHNNVVNCLSKRNQTIW
STILSEKNISTNNTNRMREKNGSTRKRNKINSIFFLNLKKKKLPHLLAFHSEDCEYCNSM
EPLLKKLKDEEGIEFLKLEMYENSYNFELLQQLDYNNLCGGLPYYYNLKTHYNICGATTY
HNLRKWAFDKKCNPNEPPNDEI
Download sequence
Identical sequences A0A077XF47 A0A0Y9YW77
PBANKA_124370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]