SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_130280 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_130280
Domain Number 1 Region: 4-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-62
Family Glutathione peroxidase-like 0.0000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_130280
Sequence length 195
Comment TPx1 2-Cys peroxiredoxin 13369518:13370105 forward MW:21654
Sequence
MPSIVGNQAPSFKAEAVFGDNNFGEVSLSDFIGKKYILLYFYPLDFTFVCPSEIIALDKA
LESFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNE
SVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWKKGKES
MKPSEEGVAKYLSSL
Download sequence
Identical sequences A0A077XJN8 A0A122IMV1
PBANKA_130280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]