SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_135200 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_135200
Domain Number 1 Region: 243-403
Classification Level Classification E-value
Superfamily eEF1-gamma domain 8.63e-55
Family eEF1-gamma domain 0.0000492
Further Details:      
 
Domain Number 2 Region: 82-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 2-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000608
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_135200
Sequence length 403
Comment PBANKA_135200 elongation factor 1-gamma, putative 15194849:15196311 forward MW:46786
Sequence
MDLKLLGPKNDIRCLKVQTVASFCNIKLNIPTFEIGIDDNKDEFIKESPMKRLPVLITPQ
GSLFESNAIGKYLCSIRSEHNLLGNGIFEEGQVNMWVDFCTFELEIPVCCYISNKLNEKS
LKHIQDTFSCLNKHLLLNQYMVGNNITIVDIFMSVIINFCIKSGKMTEAFLKQYGNLYRL
YTTIINQKQFKYVMGSGSAVNNKKTPTQPKQPNNKEKKKPKEDADDDINLFSDDGLNEKK
TKKTNPLDLLPPSKFSLDNWKYKFSNEKDLLKNAMPTFWETYDSNGFSLYYMKYDKLEDE
CQISFVACNMASGFLQRLENNFSKYSFAVISVLGENKNYDIEGVWLFRGTEIPFEMKDHP
SFEYHIFKKLDINNSNDKKLVEDYWCSKEIISNRPVCDRKVWK
Download sequence
Identical sequences A0A077XGY9 A0A122ISF6
PBANKA_135200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]