SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phchr1|1556|fgenesh1_pg.C_scaffold_2000534 from Phanerochaete chrysosporium RP-78 2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phchr1|1556|fgenesh1_pg.C_scaffold_2000534
Domain Number 1 Region: 451-557
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000023
Family HMG-box 0.001
Further Details:      
 
Domain Number 2 Region: 336-387
Classification Level Classification E-value
Superfamily HMG-box 0.00000746
Family HMG-box 0.0047
Further Details:      
 
Weak hits

Sequence:  jgi|Phchr1|1556|fgenesh1_pg.C_scaffold_2000534
Domain Number - Region: 408-449
Classification Level Classification E-value
Superfamily HMG-box 0.0349
Family HMG-box 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phchr1|1556|fgenesh1_pg.C_scaffold_2000534
Sequence length 616
Sequence
MPVSPIFRHTATDDGLAIAIAASDMSLNDHSPFLAFDDVHAYDSAAADNMIFDFDDAVAF
ESKHHMSWEPTPHDYPLSPPSFLPGSPESTTSQLDLGAPLQHLPPSAHSYSSFADVSQHA
QHDFSYSQWLQEDPASSAPIDIPISHSHSSTSSLAAFSDNSSVFPDVGPFSPTTAYAALQ
PLPRSFSPGEDDYANQALQAQPALSTSPSEPPLSPPTWASQLWTPPPTTQPLPATPSSAA
SPDDEDAYATQRPRMALRRNFAPVSELFPSSSAPSVSHMRPSMSRSYSRRAESISEHDDA
TVRRKKRSLVSGDEEHRPTERTGEGKSNDAPQKSVLRPPKLAPSAWQLYFTDWIQRHQAT
SPKKLNVAQAAKEAGQEYARLTPEEKEVRISTLSLTIRLPADLCYLSQPYKRRSQAAKEA
REREHSAYMRTLTPDDIKRENAFRTAQRKAGKSRKGNIKDPNAPKKPLSAYFMFLQRIRS
DPVLVHEVFGDETETTKQSVLAAAKWRSMTDEERKVQPRFGITMAQTNLILLQPFLAQAE
QEKLEYEAARKLYEEGTTGSPSSINFSILPNNPINSIAFPSSSFLRPVKQETTSSESEGE
DAADSDLARRRAHSHA
Download sequence
Identical sequences jgi|Phchr1|1556|fgenesh1_pg.C_scaffold_2000534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]