SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883445|ref|YP_002427827.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883445|ref|YP_002427827.1|
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-35
Family GHMP Kinase, N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 164-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.08e-27
Family Galactokinase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883445|ref|YP_002427827.1|
Sequence length 316
Comment mevalonate kinase [Desulfurococcus kamchatkensis 1221n]
Sequence
MTCSIAPGKIILFGEHFVVEGYPAIGLAVGLYARTCVEEGDLKIYSRQLGPIDPSSKEAK
PYMRIIEEASIRYGCRDRYRIYIDSEIPVGAGMGSSAAVNVSLAHSLLETCGVEFTKEDV
SRIAYLGETMVHGKPSGVDNTLSTYGGLVYYRQGLFKRLNTSLPENTALIVADTGVKRDT
GLVVREVLERYRRLGGLGKAIYEVAGRLVEEAAVAIEKGDVSRLGELMIVNHGLLFAMGA
SAWINDYLVYKMINNGAQGAKLSGAGRGGIVIGIARLENTGKIMEALKTEKVNAYLVKPD
YDGVRSINTRVSPMKH
Download sequence
Identical sequences B8D347
gi|218883445|ref|YP_002427827.1| 490899.DKAM_0131 WP_012607802.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]