SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883493|ref|YP_002427875.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883493|ref|YP_002427875.1|
Domain Number 1 Region: 237-291
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00001
Family CAP C-terminal domain-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883493|ref|YP_002427875.1|
Sequence length 292
Comment hypothetical protein DKAM_0180 [Desulfurococcus kamchatkensis 1221n]
Sequence
MSISITGSRGGFFSKLLWAFKPKDPFVRNIEESIVLMDRMIRSIEASKRSLEITLEEHKR
KLKLSGVQDKELQEIIDEENRNIMGYLNLFTKVYYDLTRVRLRLETITQVQEPMKVLPEV
LEELKRIEPEVEKINPQLVSLIRMIEQKVGSIKVSTDSSSIPQPLINKYMSQKNEEKTPV
KPVENIEALVPPATVDERARAAVKIPPPSPSNNGQQASKPVEVEPEFQRGSIESRKEVPL
NIVEQWVLAELRSKAGILDIQYFTSKYRVSRDTVYEVLRRLEEKGLVRLKRF
Download sequence
Identical sequences B8D2W1
gi|218883493|ref|YP_002427875.1| 490899.DKAM_0180 WP_012607850.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]