SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883510|ref|YP_002427892.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883510|ref|YP_002427892.1|
Domain Number 1 Region: 56-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000835
Family GHMP Kinase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218883510|ref|YP_002427892.1|
Sequence length 294
Comment GhmP kinase putative ATP-binding protein [Desulfurococcus kamchatkensis 1221n]
Sequence
MVNPFIRGARRYISAGVAVSYPNNVVIVKEGSELRVEGCRSDEVFTRIKDFAVKHGLKGI
IEIRECIPRHIGLGSTTQLVLAAGYGLALVNNHLIDPVEIAVETGLGKYSGVGTYVFKHG
GFVVDMGRSESTAFPPLLTRLEFPEEWVFIIAIPSGSGLDEEREDRIFAEENWNIPVELT
WKASYHLIELSSAVAERDFDSFVKALTALQETVGSMFSRYQGGVFSVNSARVIKLLRENG
VEGVGQSSWGPAVYGVVKGLDEAEAILENLMPRLDGKVFITRPRNKGVEVVEEK
Download sequence
Identical sequences B8D2X8
490899.DKAM_0197 gi|218883510|ref|YP_002427892.1| WP_012607867.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]