SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883648|ref|YP_002428030.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|218883648|ref|YP_002428030.1|
Domain Number - Region: 63-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000197
Family GHMP Kinase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883648|ref|YP_002428030.1|
Sequence length 280
Comment kinase (sugar kinase superfamily)-like protein [Desulfurococcus kamchatkensis 1221n]
Sequence
MKIKIPLHVSGLWIPSISSSYLETGSYGAGLNLAMYIEADIVDDRECGIYINNARVLGEQ
SMEICNNTGTSISVNAYSPVSLGRGFGISAGLLIAHALASYHALKYSSMKALQLAHVLEV
KYLTGLGDVLSEYTGGFAIRLKPGAPGVGIAHRVVVFEKPVLIVGELSSGESTQVMLSRI
TSELYEVAFSYYKKLVESEDLLDFFNYSQLFTRKVFDYSVVDKILSGRKGIISYYLKKSA
LIIWVEKEYASEIHELLSSNGIKAFETTISDRGVMVEHPG
Download sequence
Identical sequences B8D3I2
gi|218883648|ref|YP_002428030.1| 490899.DKAM_0337 WP_012608005.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]