SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883652|ref|YP_002428034.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883652|ref|YP_002428034.1|
Domain Number 1 Region: 7-266
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.73e-102
Family Ketopantoate hydroxymethyltransferase PanB 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883652|ref|YP_002428034.1|
Sequence length 271
Comment 3-methyl-2-oxobutanoate hydroxymethyltransferase [Desulfurococcus kamchatkensis 1221n]
Sequence
MSALNTRVTVRDIVKMKGKEKIAMVTAYDYTTAKLVDQAGIDIILVGDSVGMVVHGLDTT
IPVTMDMMLLHVSSVARARPRALVVGDMPFLSYETSIEDAVRHAGLLMKAGADAVKLEGG
SELSDVVKVLVRAGIPVMGHIGLTPQRSFLIGGYRKRGVSEREREKILEDARELERAGVF
SMVIEYTAADVADEVTREVSVPTICIGSGPFCDGQVLVIHDLLGLTENPPPFAKAYADLR
SIIVNAVKEYVREVKNGVFPEEKHYFYSKKQ
Download sequence
Identical sequences B8D3I6
gi|218883652|ref|YP_002428034.1| 490899.DKAM_0341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]