SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883728|ref|YP_002428110.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883728|ref|YP_002428110.1|
Domain Number 1 Region: 22-374
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 2.49e-102
Family Nqo4-like 0.00000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883728|ref|YP_002428110.1|
Sequence length 405
Comment NADH-ubiquinone oxidoreductase, chain 49 kDa [Desulfurococcus kamchatkensis 1221n]
Sequence
MAVTKIIEVPFTLEIPVGPQHPALHEPVLLKAYADGEEIVKVDINTGYNHRGIEKLCEKN
SFYRDIFIVGRVCGICNAVHANAYVRALEAILDVTPNNRARYLRVLAMELERIHSHMLIN
AVMAENIGFEALFMNIMLDREKVMKAKEIVTGARVMADYMMVGGVRRDIDDVKRDKLRKL
ISELRPRVEYYRKVFEEDETILKRLIDVGRLKPVDVTSHGLLGPVARASGVKIDTRASDR
YDAYNEIPFDVVTRNEGDSWARMMVRWDEVLEAINMVEYILEKLPSDGNPVPDEKKLPRK
FPLGEAYTRVEAQRGELTYYVMSDGKGMNPYRVKIRTPSFNNIINTGFMYIGHTIPDLPV
ILTSLDPCISCMERVTVVDLEKNIVYKVSLKELGGGKWGSRRYSI
Download sequence
Identical sequences B8D3R2
WP_012608085.1.40753 gi|218883728|ref|YP_002428110.1| 490899.DKAM_0417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]