SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883767|ref|YP_002428149.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883767|ref|YP_002428149.1|
Domain Number 1 Region: 163-441
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.73e-71
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000904
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 7.32e-23
Family Seryl-tRNA synthetase (SerRS) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883767|ref|YP_002428149.1|
Sequence length 459
Comment seryl-tRNA synthetase [Desulfurococcus kamchatkensis 1221n]
Sequence
MSWSILTLLRDNPELLKEHVKKRFMDPSLVDEAYKLDLEWRRLLSQVQELRHRHNVISRD
ISKLPEPERSARINEARELLSQMEELEKKLKEIEDLREEALLKLPNIVHETVPVGPDDTY
NVPIRFWGKPKVWSGYIEQFMQQTERYGFKVEYELVNWKPVGHADMLEYVLRLGDTVKAG
EVAGSRFYYLFDDIVFLDIALLMYAIDSLTSKGYKLVLPPYMLRHKVMSGVIDLATFKDA
IYKIEGEDLYLIATAEHSLAALHAFEEIPEEELPLKYVGVSPCFRKEAGAGNRDLKGIFR
VHQFHKVEQYVYAKPEESWALMEELIGNAEDLFKGLELPYRVVNIASGDLGAPAAKKYDL
ETWMPAQGLFREMVSCSNTTDWQSYRLKTRLVRRKGMVKEYVHTLNSTAIASTRTITSIL
ENRQNEDGTVTVPRVLRKYLEVFNKAPRDYIHPVKRERA
Download sequence
Identical sequences B8D3V1
490899.DKAM_0456 gi|218883767|ref|YP_002428149.1| WP_012608124.1.1384 WP_012608124.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]