SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883786|ref|YP_002428168.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883786|ref|YP_002428168.1|
Domain Number 1 Region: 91-248
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-24
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0022
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000714
Family Ferredoxin reductase FAD-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883786|ref|YP_002428168.1|
Sequence length 256
Comment putative dihydroorotate dehydrogenase electron transfer subunit [Desulfurococcus kamchatkensis 1221n]
Sequence
MYYPAKITGSEKLSKTLYLKRIKILSDGIKEPLPFQFLLAWVPGVDLLPMSVADFSNGEV
VIIVKERGEGSRALIRLHSGFLGVMGFYGAGFKPWSYKRILFIAGGSGIAPFFYLARKAC
EEGVSVDLVWGVRGGDELFNPRSLLNTVNKDTAIYVATEDCSAGYCGRASMLASRVIHEN
PGKWDLVIASGPQGLLREVCSLLSDTGIELYVNTETLVKCGVGACGSCVLKPHSLLLCKH
GPVFRCRDIEGFLKGG
Download sequence
Identical sequences B8D3X0
490899.DKAM_0475 gi|218883786|ref|YP_002428168.1| WP_012608143.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]