SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883859|ref|YP_002428241.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883859|ref|YP_002428241.1|
Domain Number 1 Region: 215-491
Classification Level Classification E-value
Superfamily Radical SAM enzymes 2.35e-16
Family Biotin synthase 0.058
Further Details:      
 
Weak hits

Sequence:  gi|218883859|ref|YP_002428241.1|
Domain Number - Region: 85-220
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.0183
Family MTH1675-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883859|ref|YP_002428241.1|
Sequence length 505
Comment Fe-S oxidoreductase [Desulfurococcus kamchatkensis 1221n]
Sequence
MGYEIVLTSDRTMMSNHHGKEFLGFIATGPPIAMPESLWMMLAAPKVKVDDAGRPREAPY
GMRKIEAVLMDAGFNAAIIDPDHIDKHLDSMKILMLSHHDYFAYGPPSSEWWSITGMEPI
NRRSFIRFMNSPVVRKAKEKGVKIIVGGPAAWQWLYELELMDKWGVDTIVDGEGEKVVVE
LVEKALRNEPLPRYVYVGAGDVPGVNEIPVIKGASVNGLVEIMRGCPRGCRFCSVTLRPL
RFIPLEKILAEIDVNIRSGLKGAILHSEDVLLYHADGVKPRPDPILRLHREVLERIGEKR
SLAWSHASLAAVKYAEENHKLISKLMNELVLNEHRRFLGVEVGIETGSVKLAHEIMRAKS
SPYPVEEWPNVVEDAFRIMHENKIIPAATVILGIPGETPDDVMKTIELIERLKPYRSIIV
PMFFVPMGALKHNAWFLRDHLKHEHIDALLAMYNHTIYWAEDIMNKFYFSEPYHAPLKLL
LKYFMGYVRKQVNRYAGRLEEIIKK
Download sequence
Identical sequences B8D443
490899.DKAM_0548 WP_012608216.1.40753 gi|218883859|ref|YP_002428241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]