SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883942|ref|YP_002428324.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883942|ref|YP_002428324.1|
Domain Number 1 Region: 4-247,284-403
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.12e-105
Family Pyruvate phosphate dikinase, N-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 516-817
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 6.85e-95
Family Pyruvate phosphate dikinase, C-terminal domain 0.00071
Further Details:      
 
Domain Number 3 Region: 377-488
Classification Level Classification E-value
Superfamily Phosphohistidine domain 1.96e-36
Family Pyruvate phosphate dikinase, central domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883942|ref|YP_002428324.1|
Sequence length 830
Comment phosphoenolpyruvate synthase [Desulfurococcus kamchatkensis 1221n]
Sequence
MNKENKFVLWLEEVRKEDVPLVGGKNANLGEMINAGIPVPPGFAVTAYAFKYFLEKTGLG
EKIYGMLRKLDVNNTKELEETTAKIREMIMNQPMPPEVEEEIKKYYIELAKKLGMDPNKL
RVAVRSSATAEDLPEASFAGQQDTYLNVYGADSVVYHVKRCWASLFTARATFYRVAQGIP
HEKTFMSVTVQKMVNSRSAGVMFTLHPVTGDENVVVIEGSWGLGESVVGGKVTPDEFVVD
KKTLSIVEKHINRKIFMITFDPALGKNVHLKWDDQKGRWVAEEGENISPPLAQVANPDKQ
ALTEEEVRKLAELALLIQRHYGKHMDIEWAIDSDLQFPANVFIVQARPETVWSTRKAKEA
EKKPEEVKGKTVKLGEAKVLIRGLPASPGIGAGVAKVIFDPKSKEAMEFKEGDILVTKMT
DPDWVPLMKKARAIVTDEGGMTSHAAIVSRELGIPAVVGTGNATQVIKSGVEVTVDGGRG
VIYEGIVEELVKPKAEAKTEGVVAAVGISPEQLLPLYPVTATRIYMNLGEPDAIEKYKDL
PFDGIGLMRIEFIFTDWVQYHPLYLIEIGKPEIVVNKLAEGIAKVAQAIYPRPVVVRFSD
FKTNEYRGLKGGEKYEPEERNPMIGWRGVSRYIHPKYEPGFRLEVRAIRKVREEMGLSNV
WVMFPFVRTTWELDKAIKIMEEEGLKRSKDFKVWAMAEVPSIALLADKFAEYVDGFSIGS
NDLTQLVLGADRDSNILAEMGYFDERDPAVLEAIRMIIEKAHSKGATVSICGQAPSVYPE
IVEFLVRLGIDSISVNPDAVISTRRLVASVERKIMLERLNKIIEKLKDFE
Download sequence
Identical sequences B8D4C6
gi|218883942|ref|YP_002428324.1| WP_012608298.1.1384 WP_012608298.1.40753 490899.DKAM_0631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]