SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884029|ref|YP_002428411.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884029|ref|YP_002428411.1|
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-30
Family Nitrogenase iron protein-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884029|ref|YP_002428411.1|
Sequence length 242
Comment nucleotide-binding protein, mrp/nbp35 family [Desulfurococcus kamchatkensis 1221n]
Sequence
MIEDPRIHNIVRNLSSIRNVYAVVSSKGGVGKSTVSTLLALHASRRFETGLLDIDFTNPS
THILLNLNPGELKYEEEKGILPYDLKGLKYFSIVAYTMDKPLPLRGEAARSALRELLAIV
KWGRLKLLFIDTPPGMSDEHLDLVYMLRDIVKPIVVSTPSILSVKSAARLVSVLREAGFK
WIGFIENMGNESLRGNEVLGDVEYLGYIPYTPGIESCLGSRMVEACIDPGLLDSILSRLT
EL
Download sequence
Identical sequences B8D4L3
WP_012608385.1.1384 WP_012608385.1.40753 490899.DKAM_0718 gi|218884029|ref|YP_002428411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]