SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884252|ref|YP_002428634.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|218884252|ref|YP_002428634.1|
Domain Number - Region: 10-42
Classification Level Classification E-value
Superfamily Prefoldin 0.0262
Family Prefoldin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884252|ref|YP_002428634.1|
Sequence length 44
Comment hypothetical protein DKAM_0941 [Desulfurococcus kamchatkensis 1221n]
Sequence
MYPYSATPTMTREAEIAYLENLKAYLQDTLKYIEDRLNQLKNSK
Download sequence
Identical sequences B8D586
gi|218884252|ref|YP_002428634.1| 490899.DKAM_0941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]