SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884265|ref|YP_002428647.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884265|ref|YP_002428647.1|
Domain Number 1 Region: 22-373
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 2.22e-96
Family Nqo4-like 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884265|ref|YP_002428647.1|
Sequence length 373
Comment NADH-ubiquinone oxidoreductase, chain 49 kDa [Desulfurococcus kamchatkensis 1221n]
Sequence
MEGISMAGKGRLVEIYFGPQHPGAPGNIAFKLTLDGERVVNVETIPGFLHRGFEKMMENR
TWEMNVVLSYRFCVEDPDPLEIAYAMAVEKIHGVEIPENAKYIRMIQAEFSRIASHLFWS
HFIGGSTGLRTPAYWALVAREEILKWFARFAGHRVYHNISVPGGVRYPLPKSFVEDTLRL
TNFVEEKVRDVEAALLKNNIFRDRTRGVGRLSSKEALELGVTGPVLRAAGLPYDLRKVTP
YLNYDKIQFEVPIVQNGDAYDRSVLRFREIYESLKIIRESVKRIDPEGGLRVKLPLTAPP
GEGIARVESARGEYMIHIISTGGRKPYRVRLKSMSLPLMTTVVEYIVKRDEVTIADFPIL
LASLDPCAPDIDR
Download sequence
Identical sequences B8D599
gi|218884265|ref|YP_002428647.1| 490899.DKAM_0954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]