SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884386|ref|YP_002428768.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884386|ref|YP_002428768.1|
Domain Number 1 Region: 19-205,253-364
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.17e-47
Family tRNA pseudouridine synthase TruD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884386|ref|YP_002428768.1|
Sequence length 370
Comment tRNA pseudouridine synthase D [Desulfurococcus kamchatkensis 1221n]
Sequence
MDSDTGRIYPHPLDYVSGLKYSLTSLSVNHEYRITPSSFIVREVIDEGYLVKRVDLHGRE
GYIVVRVVKRGLDTFEALRILSRKLDIPVENIHFHGLKDKNATTTSYFYIKRLLVDERIF
PIQGDKAVFEIAGYTRFKPGREIFKGNEFEVLIQGLDERQQEVMKRILELISRHGLPAYY
GYQRFGVKRYNTHLLGKYVVKRRENCFSRILLDTMYPGEDLEAIVKRIRRDFTGFYYEGR
YVRAGYNGLGLKNVLRALNEIIIDAYAGYLYNLLLNKIIEEKGFVDLDKEYPMPGCIESV
ELYSGIFSEEGLTLEEARSLPCYYRNGLFKPLNTRMSCAGDVCRLVFMLEPGLYATIVLR
ELFKEKLVLS
Download sequence
Identical sequences B8D5M0
490899.DKAM_1075 gi|218884386|ref|YP_002428768.1| WP_012608742.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]