SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884458|ref|YP_002428840.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884458|ref|YP_002428840.1|
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.06e-68
Family Pseudouridine synthase II TruB 0.000000244
Further Details:      
 
Domain Number 2 Region: 254-335
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-20
Family PUA domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884458|ref|YP_002428840.1|
Sequence length 345
Comment H/ACA RNA-protein complex component Cbf5p [Desulfurococcus kamchatkensis 1221n]
Sequence
MDLVEKGLSFIDYITARAGYRNEWIVLRDAETSPDHGVLPYERKVNDHINYGVINLDKPP
GPTSHEVVAWVKKMFNLEKAGHGGTLDPKVTGVLPIGLANSTKVIGNVIHSVKEYVMVIQ
LHGDARESSVKMVVEYFKGDIYQKPPLRSSVKRSIRVRRIYEIELLEIRDRFILVRVLSD
PGTYMRKLAHDIGLMLGTGAHMRELRRTRTGPYREDETLVRLQDISEALALWRSSGDERY
IRRIILPVETSIAHLPKIMILDTAVDAIAHGANLAVPGIARLTSNVERNKTVAILTLKGE
LVALGTALYSAKEIAGMKKGVVARTRRVVMPTGIYPPAWRKGQPG
Download sequence
Identical sequences B8D5U2
490899.DKAM_1147 gi|218884458|ref|YP_002428840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]