SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884466|ref|YP_002428848.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884466|ref|YP_002428848.1|
Domain Number 1 Region: 136-214
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.97e-21
Family Translational machinery components 0.0015
Further Details:      
 
Domain Number 2 Region: 52-123
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.7e-20
Family Ribosomal S5 protein, N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884466|ref|YP_002428848.1|
Sequence length 217
Comment 30S ribosomal protein S5P [Desulfurococcus kamchatkensis 1221n]
Sequence
MISVSASAVDKAALEKWVPRTRVGKMVLEGKITSLKEVFDRNLPLLEPEIVDYLLPDLKY
ERIDTKIVQKMTDAGRRTRFLVVVVIGNENGFVGIGTGKAKQYVDALAKAIRNAKLNITP
VRRGCGSWECRCGEPHSVPFTVRGKSGSVEVVLKPAPRGTGLVAGDVAKVVLRLAGLRDV
WTESFGETRTTLNFAKAVVNALYNTYKFVTPVDWLKA
Download sequence
Identical sequences B8D5V0
WP_012608822.1.40753 gi|218884466|ref|YP_002428848.1| 490899.DKAM_1155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]