SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884530|ref|YP_002428912.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884530|ref|YP_002428912.1|
Domain Number 1 Region: 309-471
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-53
Family DNA gyrase/MutL, second domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 17-228
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.58e-37
Family DNA gyrase/MutL, N-terminal domain 0.000000324
Further Details:      
 
Domain Number 3 Region: 232-304
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000000000824
Family Topoisomerase VI-B subunit middle domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884530|ref|YP_002428912.1|
Sequence length 530
Comment DNA topoisomerase VI subunit B [Desulfurococcus kamchatkensis 1221n]
Sequence
MGETPVEKYRAISPAEFFYKYREIAGFSNPARAIYQTVRELVENALDATDAHGIMPDIKI
SIRKVDEIQEFYRITVEDNGIGIPPDVVPDAFGRVLFSSKYVLRQTRGMYGLGVKMAVLY
GQMTTGRPVEVITSKPGFKRIYYFKLRIDVNRNEPVIIERGSWRKNREWHGTIVSITIEG
DWGRAKPKIKEYLFKTAIVTPYANIVALTPDDEIIYYPRIIDKIPRPPLEVKPHPHGVDL
ELLKQIISSHNYTSVEELLIKGFQSIGEATAKSILQQAGIDPGKPISELSDNELLSLVNT
LKSMKDIRAPSIKAISPLGSDVIIAGLKRVFQPEFVYAVSRRPQAYQGHPFIVEAGIAYG
GKTPMSDDDKPIILRYANKIPLLYDEGSDVTTMVVKEDISWDHYMVSFPAPIAILVHVCS
TKIPFKGVGKESIADVPEVRKEIKLVLMDVLRELKKYLSKKAKEEELKKRAEHLTKYIPE
VARGLSVIVANGSKDFEVKLVQKLVSIISRRTGIPESEIQQVLESIRIGT
Download sequence
Identical sequences B8D614
490899.DKAM_1219 WP_012608886.1.40753 gi|218884530|ref|YP_002428912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]