SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884628|ref|YP_002429010.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884628|ref|YP_002429010.1|
Domain Number 1 Region: 9-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.22e-67
Family G proteins 0.00000563
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-53
Family Translational machinery components 0.0000212
Further Details:      
 
Domain Number 3 Region: 260-383
Classification Level Classification E-value
Superfamily Translation proteins 5.11e-29
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 629-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.55e-21
Family EF-G/eEF-2 domains III and V 0.0055
Further Details:      
 
Domain Number 5 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.58e-19
Family EF-G/eEF-2 domains III and V 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884628|ref|YP_002429010.1|
Sequence length 736
Comment elongation factor EF-2 [Desulfurococcus kamchatkensis 1221n]
Sequence
MVKFKQTSEVLKIMGNIEQIRNIGITAHVDHGKTTLSDTLLSAAGLISEKIAGQALALDY
LDVEQKRQMTVKAANASLYHEYKGKPYLINLIDTPGHVDFQSKTIRALRVIDGAIVVVDA
VEGVMTQTEMYLRVALEERVRPVLFINKIDRLIKELRLSPTEIQQRLVQIVRDVNTLIAT
YADKEFQKAWLLDPMKGQVAFGSARDRWGLTIPLVQQKGIKFSDIVDVYTRGKEAVAELQ
KTAPLHEAILDMVVKHIPNPREAQRYRIPKIWHGDPNHEIVKYLMEADPNGPLVMLINDI
RVDPHAGLVATGRIYSGTLRPGEEVWLVNARVPQRVLQVSLYMGPYRELADEITAGNIAA
ALGLEKARSGETVVSMKYKDTMTPFEKLKMITESVVTVAIEPKNPQQTTKLIDALYKLHL
EDPSLIVKINEETGEYLLSGVGTLHIEIALTLLKDLYGLEVVTSPPVIVYRETIRDRSQV
FEGKSPNKHNKFYISVTPLNEETLRLLSEGIIMEDMDARERAKILREQAGWDADEARRIM
AIDENLNILIDMTTGVQYLREVKDTIIQGFRLAMREGPLAMEPVRGVKVVLHDAVIHEDP
AHRGPAQIFPAVRNAIFAGFLTARPTILEPILKLDIRSPMEYIGNISSVITKKRGKLIEV
QQMETTARVIAEIPVSESFDIADMLRNVTAGKAIWGQEFSRWAPVPENMLMDLIAKIRTR
KGLKPEPPKPEDFLSP
Download sequence
Identical sequences B8D6B2
gi|218884628|ref|YP_002429010.1| WP_012608984.1.40753 490899.DKAM_1317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]