SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884634|ref|YP_002429016.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884634|ref|YP_002429016.1|
Domain Number 1 Region: 10-176,205-219
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-48
Family Ribonuclease PH domain 1-like 0.00000388
Further Details:      
 
Domain Number 2 Region: 191-275
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.24e-22
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884634|ref|YP_002429016.1|
Sequence length 286
Comment exosome complex RNA-binding protein Rrp42 [Desulfurococcus kamchatkensis 1221n]
Sequence
MSITPEKEPLLPRIQVENIVKSIKKGERIDGRGLTDYRPIEVILNPITKASGSSLVKLGG
TQVIAGVKLELEEPFPDRPGEGVLQVHAEFVPLASPSFEPGPPDENAIEVARVIDRSLRE
SKAVKLDALAIEPGKIVWSVYTDIYLVDHQGNIIDTGMLASMLALATSRIPELIKGENGY
KVDHTKYVGPLPINTLVATVTMGIYNDVIIVDPLLEEEAVIDSFITIAIDESGRICGIQK
RGMKGFSRSVLDNTIEIALSKGRELVDLMKKILNNPSEYMKPLVSE
Download sequence
Identical sequences B8D6B8
490899.DKAM_1323 WP_012608990.1.1384 WP_012608990.1.40753 gi|218884634|ref|YP_002429016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]