SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884720|ref|YP_002429102.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884720|ref|YP_002429102.1|
Domain Number 1 Region: 326-441
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0000000000719
Family Pseudouridine synthase II TruB 0.019
Further Details:      
 
Weak hits

Sequence:  gi|218884720|ref|YP_002429102.1|
Domain Number - Region: 165-204
Classification Level Classification E-value
Superfamily THUMP domain-like 0.000785
Family THUMP domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884720|ref|YP_002429102.1|
Sequence length 447
Comment putative pseudouridylate synthase [Desulfurococcus kamchatkensis 1221n]
Sequence
MIMETPQQNRCGEHCSIIETAAKILSEYPLCDRCLGRVFAKKGIELSNEERGRAIKTLLA
MKLYADYTSEIIDAEYIGKIASNTGDPVTRLYRKITDREISVNPCYICLHRVSSDYIDEI
ARRVAVKLSELNASSFIIGVKLDSEVVKKELDVHVLAGLESSESLKNELKREIGKRVTQL
TNIPPDFDKPDVVVIVDVNKDFDYSIQTQVNPILLKAIYFKRGRRISHVPWFTSNGSRKY
PESIQDFIRDSIARLFDARDIKIHAAGREDVDARMLGSGRPLVIEVKEPGFRNVDLDLLN
YILDDQFIKVSVIGAATRRDIESIKEGSRKRRKIYRVAVLTEKPVSEGDLEKLSSFFKER
SVKQRTPTRILRRKKDRERIKRVYRIEVISISSRVFEALIYCDGGLYVKELVHCDNGRTT
PCFSEILGTPAYPLELDVLYIEKTWDK
Download sequence
Identical sequences B8D6K4
WP_012609076.1.1384 WP_012609076.1.40753 490899.DKAM_1409 gi|218884720|ref|YP_002429102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]