SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884332|ref|YP_002428714.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884332|ref|YP_002428714.1|
Domain Number 1 Region: 177-524
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.03e-112
Family Nqo4-like 0.0000199
Further Details:      
 
Domain Number 2 Region: 17-182
Classification Level Classification E-value
Superfamily Nqo5-like 1.28e-30
Family Nqo5-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884332|ref|YP_002428714.1|
Sequence length 545
Comment NADH dehydrogenase (ubiquinone), 30 kDa subunit [Desulfurococcus kamchatkensis 1221n]
Sequence
MHSQTLLDRYIQLAGKLGGKHLVEGDMVHLYIPRENLVKAASTLFNEYRLTHRTCVAIDE
RPLNGFFTLTHIFTDDSSRLYVLVKTYLEGDNPVAPSIVGEVPAADWCELEAMDLLGIQF
EGRRRERLVLPPYWPDGVYPLRKEFSYDQRLNLHAVSEKIEQAGETGVPVPIGPYHPALH
EPEYFELYVEGERILDVKYRGFHVHRGIEKLAESRMTYQQVNFLAERICGICGFEHSTCY
ALAVEKAAKLDVPERAQFIRSIVLEVERLHSHLLWLGVAFHTLGYDAGFMHMWRIREKVM
ELAEALTGSRKTYGINMVGGVRRDINEEKRKKTIEVLNELEKEFSKIIDVAISVPQVKKR
LTGTGVLPKEWAVKLGVEGPVARASGVDRDARRDLPYAAYKHASFKVPVYTEGDNMARAL
VRVDEVKESMSIIIQLLDAIPRGPIMLDKYEIPEGRIGVQVVEAPRGGDIHYVLTGKGKP
YRWRVRAPTYNNIPALRIMLRDQSLADAPLTIASIDPCFSCTDRIMVIRENGRVERISFN
RGVPL
Download sequence
Identical sequences B8D5G6
gi|218884332|ref|YP_002428714.1| WP_012608688.1.1384 WP_012608688.1.40753 490899.DKAM_1021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]