SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000059 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000059
Domain Number 1 Region: 158-228
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 53-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000571
Family LIM domain 0.045
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000246
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000059
Domain Number - Region: 93-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00247
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000059   Gene: ENSFCAG00000000066   Transcript: ENSFCAT00000000065
Sequence length 338
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:31322109:31327217:1 gene:ENSFCAG00000000066 transcript:ENSFCAT00000000065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVSYRLLGLGLXCSVCSRQLLPGDEFSLREHELLCRADHG
LLLERAAAGSPRSPGPLPGARGLHLPVLADPASGRQPSLRPHVHKQTEKTTRVRTVLNEK
QLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQH
NDKTSLQGLTGTPLVAGSPIRHESAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQL
VSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences ENSFCAP00000000059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]