SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000096 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000096
Domain Number 1 Region: 58-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000278
Family Ankyrin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000096   Gene: ENSFCAG00000000103   Transcript: ENSFCAT00000000103
Sequence length 379
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:33209162:33219107:1 gene:ENSFCAG00000000103 transcript:ENSFCAT00000000103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPSPQVPEGEASTSVCRPKTSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLD
VDAGQPPPLHRACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPL
LSRCPSAMGIKNKDGETPGQILGWGPPWDSAEEEEEDEASKEREWRQKLQGELEDEWQEV
IGRFEDDASHETQEPESFSAWSDRLAREHAQKQQQHEAEGARRPPRAEGSGHNWRQQEEE
QRLFRERARAKEEELRESRAKRAQEARGDRGPEPARAGPRAEHPRGAGRGSLWRFGDVPW
PCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRFRSQIETWELGRV
MGAVTALSQALNRHAEALK
Download sequence
Identical sequences M3VU41
ENSFCAP00000000096 XP_003985961.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]