SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000148 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000148
Domain Number 1 Region: 25-194
Classification Level Classification E-value
Superfamily Lipocalins 2.36e-38
Family Retinol binding protein-like 0.0016
Further Details:      
 
Domain Number 2 Region: 226-283
Classification Level Classification E-value
Superfamily BPTI-like 7.24e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00022
Further Details:      
 
Domain Number 3 Region: 286-339
Classification Level Classification E-value
Superfamily BPTI-like 8.09e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000148   Gene: ENSFCAG00000000163   Transcript: ENSFCAT00000000163
Sequence length 352
Comment pep:known chromosome:Felis_catus_6.2:D4:76129549:76143197:-1 gene:ENSFCAG00000000163 transcript:ENSFCAT00000000163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLRALFLLVTACLAVSASPVLTPPDDIQVQENFDISRIYGKWFHVAMGSTCPWLKKFM
DRMSMSTLVLGEGAKDKEISMTSTRWRRGTCEEISGAYEKTDTDGKFLYHKPRWNITMES
YVVHTNYDEYAILLTKKFSHHHGPTITAKLYGRQPQLRESLLEEFREVALGVGIPEDSIF
TMADKGECVPGEQEPEPSPLTRARRAVLPQEEEGSGARLLATDFSKKEDACQLGHAEGPC
LGMVTRYFYNGSSMACETFQYGGCLGNGNNFASEKECLQTCRTVAACNLPIVTGPCRGYN
QLWAFDAVQGKCVLFTYGGCQGNGNKFYSEKECREYCGVPGNGDEELLPIAS
Download sequence
Identical sequences M3VU72
ENSFCAP00000000148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]