SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000200 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000200
Domain Number 1 Region: 370-474
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000981
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000200   Gene: ENSFCAG00000000215   Transcript: ENSFCAT00000000215
Sequence length 536
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:68732901:68734511:1 gene:ENSFCAG00000000215 transcript:ENSFCAT00000000215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRYLSVKERNISIGDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNPNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDGMSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEVSGDNTAIPQVNCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
Download sequence
Identical sequences M3VUB2
ENSFCAP00000000200 XP_003984011.1.62641 XP_007084774.1.5354 XP_014930199.1.86478 XP_019682701.1.62641 XP_019682702.1.62641 XP_019682703.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]