SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000280 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000280
Domain Number 1 Region: 1265-1407
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-52
Family Phosphotyrosine-binding domain (PTB) 0.000000125
Further Details:      
 
Domain Number 2 Region: 297-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-35
Family PLC-like (P variant) 0.0041
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.19e-26
Family Dual specificity phosphatase-like 0.00024
Further Details:      
 
Domain Number 4 Region: 1111-1260
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 23-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000280   Gene: ENSFCAG00000000304   Transcript: ENSFCAT00000000304
Sequence length 1409
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:81931363:81944192:1 gene:ENSFCAG00000000304 transcript:ENSFCAT00000000304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRATSRPRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGVSC
RVCKVATHRKCEAKVTSSCQALPPAELRRNTAPVRRIEHLGSTKSLNHSKQRNTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGSKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVAAELQPSQRRYISYFSGLLSGSIRMNSS
PLFLHYVLVPVLPAFEPGTGFQPFLKIYQSMQLVYTSGIYHVAGPGPQQLCISLEPALLL
KGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPRLTFPKDQLDEAWADERFPFQASVEF
VFSSSPEKIKGNTPRNDPSVSVDYNTAEPAVRWDSYENFNQHHEDSVDGSPTHTRGPLDG
SPYAQVQRAPRQSPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LDRLLGGCGVAGGGRGAGRETAILDDEEQPPVGGGPHLGVYSGHRPSLSRHCSCRQGYRE
PCGVPNGGYYRPEGTLDRRRLAYGGYEGHPQGYAEASVEKRRLCRSLSEGPYPYPPELGK
PANGDFGYRSPGYREVVIVEDPGMPALCSCPACEEKLALPTAALYGLRLEREAGEGWAGE
AGKALLHPVRSGHPLPLLVPACGHHHAPMPDYSCLKPPKAGEEGHEGCSYALCPEGRYGH
PGYPALVTYGYGGAVPSYCPAYGRVPHSCGSPGEGRGYSSSGAHSPRAGSISPGSPPYPQ
SRKLSYEIPAEEGGDRYPVPGHLAPAGALASAESPEPASWREGPSGHSTLPRSPCDAQCS
ASSELSGPSTPLHTSSPVQGKESTRRQDTTSPTLVPTQRLSPGEALPSVPQGSAEKAPEL
PARSGLELPAPGPFSPTSPPSSPKDWPQEKSPGSRSDSASPRGPVPTTLPGLRHAPWQGL
RDPPDSPDGSPLTPVPTQMPWLVASPEPPQSSPTPAFPLAASYDVNGPTQPPLPEKRHLL
GPGQQPGPWGPEQASPPARGTSHHVTFAPLLPDNVPQPPEPPMQESQSNVKFVQDTSKFW
YKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPLEQLVR
HFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEETPETPVP
ANMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALGCSPRPTPAIVHFKVSA
QGITLTDNQRKLFFRRHYPVNSITFCSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENV
CHLFAELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences A0A2I2V4Z1
XP_003988798.1.62641 ENSFCAP00000000280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]