SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000376 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000000376
Domain Number - Region: 219-283
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0316
Family Spectrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000376   Gene: ENSFCAG00000000408   Transcript: ENSFCAT00000000407
Sequence length 370
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:49466824:49467936:1 gene:ENSFCAG00000000408 transcript:ENSFCAT00000000407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQEEKAVRMDPPHTEEPFDKKDKKTEKQEEEMEFKELGGLREALANLRGLSEEEKSEKA
MLCSRIQEQSQLICILKRRSDEALERCQILELLNTELEEKRMLEAEKLKAMSEHAQKLEE
RFMTLAANHELMIRFKDEHKSQNVKLREENEKLRLENDSLFSQALKDQEAKVRQLTARSE
ALSKELETLKQRCTRDARQAQAREKELLELQSRQACAHAKETEQLHSQLQSLQQQHQQIA
EQMAAAEQAHGSLKQELQARLQTVTREKDELLQLSMERGRALQSKQAEIRQLEEKLETAD
VARRHALQRFEQEAVAVDSNLRVRELQRRIDGIQKAYDELRLQSEAFKKHSLGLLSKERE
LNAKLRHLFP
Download sequence
Identical sequences M3VUP8
ENSFCAP00000000376 XP_003992715.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]