SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000799 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000799
Domain Number 1 Region: 61-110
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000000235
Family Elafin-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000799   Gene: ENSFCAG00000000858   Transcript: ENSFCAT00000000858
Sequence length 110
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:15517801:15519666:-1 gene:ENSFCAG00000000858 transcript:ENSFCAT00000000858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSSFLVLAVFLILGTLAAQAAVIAVPPKGQGTDKGRVLVKGQDPVRGQDPVKTKDLLK
VPVSTKPGSCPNILMRCAMMNPPNHCLRDTECPGAKKCCHGPCGLACLDP
Download sequence
Identical sequences ENSFCAP00000000799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]