SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000875 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000875
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily DEATH domain 3.11e-18
Family Caspase recruitment domain, CARD 0.017
Further Details:      
 
Domain Number 2 Region: 640-720
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000173
Family PDZ domain 0.035
Further Details:      
 
Domain Number 3 Region: 975-1116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000226
Family Nucleotide and nucleoside kinases 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000875
Domain Number - Region: 736-799
Classification Level Classification E-value
Superfamily SH3-domain 0.0241
Family SH3-domain 0.0056
Further Details:      
 
Domain Number - Region: 121-178
Classification Level Classification E-value
Superfamily Tropomyosin 0.0392
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000875   Gene: ENSFCAG00000000941   Transcript: ENSFCAT00000000941
Sequence length 1121
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:60557621:60580526:1 gene:ENSFCAG00000000941 transcript:ENSFCAT00000000941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEETLWDMMESHRHKIVSSICPSRLTPYLRQAKVLDQLDEEEVLHSPRFANTVMRVGHLL
DLLRTRGKNGAIAFLESLKFHNPDVYTLVTGLQPKGDFSNFSGLMDTSKLTECLAGAISS
LQEELGQEKGHKEALQRRCRQLQERLGRAEAHVRSLGQLETDHDRVKREVLKLKDEMLSL
SLHHSNALQEKELAVTRCRGLQEEVPGCPKIHQVDVRGEKVQVERFFLLSLTRMADGLGP
GDKELTRLKEENEKLRSLTFSLGAGVSGGQGPGADLSLPQAEKDILEQNLDEALEGTQTL
VERIHSLRQRAVAAERQRKQYWEEKEQTLLQFQRTKVDCDIYKEKIGALQGQLLELQRER
DQAYSARDAARMEISQSLTEKDALRRKVFELTDQVWELRHRLHRPQAESLRGASTAHRLS
WVNRVAGSLKRHVGASWVCVHLSFRGPRELGEAVGDPPLPEQGPSCFLLHPPHIDHVPNT
YTYKKTAKTPPRGHPRGNSPAPNSLWPIFGSLSRKPEPRSRVQSFRSSSPMPPSQQSLCK
RATEDFCFPETLQVDRGPSPGAKAGAADLDYEIVDPAGRRVRQPSASPEGRGAEVLSSEK
GKRKAILRGPLRLSQVSGGRAPGPAGGRADFQGDELLEQISVIGGNLTGIFIHRVTPGSA
ADEMALRPGTQIMTVDYEATEPSFKATLEDTTLEQAVGLLRRVNGFCCLSVKVNVEGYKK
LVQDLEAKVATSGDSFYIRVNLALEARAVGELQVQCNDILHVTDTMFRGRGCWHAHRVGP
YSTKGTERGSIPNYARAQRLLIALIQRSTIARKVRRGEPHPDPGHGRLLWGPCLPPPRPS
SSRLTAPGGPWPRLGRLGHLLVPLLPSSSLPGNPRSWSASSAWTEPRPALCARPLRGPCR
SAAGRKVRRPERAEGPLIAPSCQAETCFTLVPYSLVRPHRPSRPRPVLFVPRVVGRILSE
KLCLLQGFKKCPAEYLSQEEYDASSQRGDIIQEKEASGGRYWVTRRAIESLMEKNTHALL
DVRLDGVRALHRSEIFPIIVHISVNEKAAKKLKKALQRLNTSERQLLEAGRQEEGELDEV
PCLYSSLAPDGWSDLETLLGCVRLAIADEQKKVVWTEKSPR
Download sequence
Identical sequences ENSFCAP00000000875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]